Protein Info for ABIE41_RS21790 in Bosea sp. OAE506

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 225 to 253 (29 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 294 (285 residues), 120.1 bits, see alignment E=5e-39

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 67% identity to mno:Mnod_1211)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>ABIE41_RS21790 branched-chain amino acid ABC transporter permease (Bosea sp. OAE506)
MTTGLLIVQILNGLQLGILLFLVAAGLTLVFGVMDFINLAHGVQYMLGAYLAVTFVGITG
SFVLGLVLALAAALVIGLALEFLVFRHLYARDHLDQVLATFGLILLLNQGVKMLWGAAPL
SVPVPAFLSGNVALLDGILYPTYRFALIGSGLAVGALLWFVVEKTRTGMLLRAGASNAPM
VSALGVDINRLFMIVFAFGTMLAAFAGAMAAPILSVEPGMGDNILILAFVVIVVGGIGSI
RGAFVGALIVGLVDTLGRSFMNDLLRLFMSAPSARAAGAALSSMLIYLVMAIVLFVRPEG
LLPSKGRA