Protein Info for ABIE41_RS21650 in Bosea sp. OAE506

Annotation: polyamine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF01547: SBP_bac_1" amino acids 43 to 304 (262 residues), 68.7 bits, see alignment E=1.9e-22 PF13416: SBP_bac_8" amino acids 46 to 333 (288 residues), 103.1 bits, see alignment E=4.8e-33 PF13343: SBP_bac_6" amino acids 80 to 313 (234 residues), 67.5 bits, see alignment E=2.6e-22

Best Hits

Swiss-Prot: 52% identical to SPUD_PSEAE: Putrescine-binding periplasmic protein SpuD (spuD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11073, putrescine transport system substrate-binding protein (inferred from 61% identity to mno:Mnod_4949)

MetaCyc: 51% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>ABIE41_RS21650 polyamine ABC transporter substrate-binding protein (Bosea sp. OAE506)
MMSGRWLRGIVSGLALGLSLAVAGQAAAQGKELRIYNWSDYVDPEVLDAFKKETGITVVY
DTFDQMETVETKLLAGKTGYDLIVVTASFLPRHIPLGLYAPVDAAKVPNLKNAWPEIQGR
LAKYDPGNKHAVNYMWGTTGIGYNVAKIRERLGPDAVIDSWKILFDADQLKKLSNCGVHV
LDAVEEMFPAALRYLGLNPDSKAEADLNKAGELLRKIRPHIQKFHSSEYINALANGDICL
AVGYSGDILQAKKRAEEAKNKVEIAYSIPKEGALMWFDSFVIPKDAANPDAALAFIDFVN
RPAMAAKNSDFIQYANGNIASKPLLSAAVRDNPGIYPPDAVMARLYTITPYDQKSQRLVN
RLWTRVKTGK