Protein Info for ABIE41_RS21495 in Bosea sp. OAE506

Annotation: NlpC/P60 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 TIGR02219: putative phage cell wall peptidase, NlpC/P60 family" amino acids 11 to 143 (133 residues), 184 bits, see alignment E=8.2e-59 PF00877: NLPC_P60" amino acids 19 to 137 (119 residues), 24.2 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: None (inferred from 63% identity to rpb:RPB_3459)

Predicted SEED Role

"Gene Transfer Agent NlpC/P60 family peptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>ABIE41_RS21495 NlpC/P60 family protein (Bosea sp. OAE506)
MSAPLERAAIVEAARCWIGTPYHHQASLRGVGCDCLGLVRGVWRDLRGPEPEAPPPHTQD
GAERLGAEMLAEAALRHLVPVAPGQERPGDVLLFRWRSHLPARHCAILSTPDRIIHAHDG
AQVAEVAFTRWWRRHLSHVFSFPGASD