Protein Info for ABIE41_RS21390 in Bosea sp. OAE506
Annotation: urease subunit gamma
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to URE23_DEIRA: Urease subunit gamma/beta (ureAB) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
KEGG orthology group: K14048, urease subunit gamma/beta [EC: 3.5.1.5] (inferred from 78% identity to bid:Bind_3307)MetaCyc: 53% identical to urease subunit alpha UreA (Helicobacter pylori 26695)
Predicted SEED Role
No annotation
MetaCyc Pathways
- urea degradation II (1/1 steps found)
- superpathway of allantoin degradation in plants (3/8 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- Atrazine degradation
- Purine metabolism
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 3.5.1.5
Use Curated BLAST to search for 3.5.1.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (206 amino acids)
>ABIE41_RS21390 urease subunit gamma (Bosea sp. OAE506) MNLTPREKDKLLVAMAAMVARRRLERGVKLNYPEAVALITDFVVEGARDGRSVADLMQAG AHVVRADQVMDGIAALIHDVQIEATFPDGTKLVTVHEPIRGASDTMKPGEVTTLPGDLVM NEGRESLSLTVSNTGDRPIQIGSHYHFFEANPALAFERDKALGFRLDIPAGTAVRFEPGQ TREVRLVAVAGKREVYGFRQEVMGKL