Protein Info for ABIE41_RS21260 in Bosea sp. OAE506

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 44 (33 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details PF01925: TauE" amino acids 17 to 270 (254 residues), 160.4 bits, see alignment E=3e-51

Best Hits

KEGG orthology group: None (inferred from 60% identity to bja:bll0510)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>ABIE41_RS21260 sulfite exporter TauE/SafE family protein (Bosea sp. OAE506)
MLAGIPVGDLVFLAISLVAAGAVTGLLAGVFGVGGGAVIVPILYEVFRVIGVPEDVRMPL
CVGTSLAVIIPTSIRSFNAHRAKGMVDMSILKIWAVPVVLGVIVGSYIARFAPADLFKII
FVIVAIFSALRLLFASDRWQLGTEMPGKVLMTIYGGVIGVLSALMGIGGGQLSSLFMTFY
GRPIHQAVATSSGLGVLISIPGALGFIYAGWPKMDVLPPLSLGYVSLIGFILFIPTSIWT
APIGARLAHRLSKRKLEVVFGLFLLIVAARFIWSLVV