Protein Info for ABIE41_RS21250 in Bosea sp. OAE506

Annotation: adenosylcobinamide-GDP ribazoletransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 66 to 108 (43 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details PF02654: CobS" amino acids 37 to 281 (245 residues), 152.3 bits, see alignment E=1e-48

Best Hits

Swiss-Prot: 47% identical to COBS_XANP2: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 54% identity to mrd:Mrad2831_1973)

Predicted SEED Role

"Cobalamin synthase (EC 2.7.8.26)" (EC 2.7.8.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>ABIE41_RS21250 adenosylcobinamide-GDP ribazoletransferase (Bosea sp. OAE506)
MKTIEDRDAAPPQAAPVPPAGAEPAWPGWAIATAICIRFYSRLPVPALPGEADPHAAPDF
RTVPRALPFAALVIALPAGLVLAGAGAAGLGGLLSATLAIATLAITTGALHEDGLADAAD
GLFGGRNVERRLEIMKDSRLGSYGALAMGLALLLRVTALALVIDRAGPVAASAVFLMAAI
LSRLSGVRLLAMMAPARAHGASAAVGRPTRLTAGLAYVIGLVLALSFCLVAGLPLRALLL
GLVLTALNAALVTRLCRRLIGGQTGDIAGATQQCDEIALYLGFALLLNAGMSWTGAA