Protein Info for ABIE41_RS21075 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 35 to 200 (166 residues), 90.1 bits, see alignment E=7.7e-30

Best Hits

Swiss-Prot: 43% identical to OPUBB_BACSU: Choline transport system permease protein OpuBB (opuBB) from Bacillus subtilis (strain 168)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 48% identity to pol:Bpro_1155)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>ABIE41_RS21075 ABC transporter permease (Bosea sp. OAE506)
MATWISANPQIFIVALQNHLWLTGVALAAVLLIALPLGLLLTRHRGFANAAIAIVNILRT
VPSLALLVIMLPLLGTGFLPSVVALTLYGLPALLLNTYTGLTEVDADIVDAARGQGFSDA
QVMTRIEIPLALPVIFAGIRTAAVQIVSAATLAAFIGGGGLGELITAGMANFNFPQLIAG
AVAVAALALAVEIGFAGIERLMTRQLRMGAS