Protein Info for ABIE41_RS21070 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 46 to 70 (25 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 123 to 156 (34 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details PF00528: BPD_transp_1" amino acids 33 to 202 (170 residues), 79.1 bits, see alignment E=1.8e-26

Best Hits

Swiss-Prot: 38% identical to OPUCB_LISMN: Carnitine transport permease protein OpuCB (opuCB) from Listeria monocytogenes

KEGG orthology group: None (inferred from 53% identity to mes:Meso_2979)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>ABIE41_RS21070 ABC transporter permease (Bosea sp. OAE506)
MSWTIENWDRLLIALWEHIQLVGVGLAIALAIGLPLGVLSARRPGFALVVLLVSGALYTV
PALAIFALLIPYLGLGFWPAIVALVAYALLIIIRNVATGLQEIAPDILDAADGMGYGRWR
RLFAIELPLALPVIIAGIRITVVTQVSVATVAAFINAGGLGDIIFQGITQDFGEKVVAGA
VVTSALAILCDESLRRVELRLRANQAETV