Protein Info for ABIE41_RS20685 in Bosea sp. OAE506

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 11 to 166 (156 residues), 158.8 bits, E=1.8e-50
• PF03807: F420_oxidored
  • amino acids 11 to 101 (91 residues), 33.6 bits, E=7.4e-12
• PF14833: NAD_binding_11
  • amino acids 171 to 291 (121 residues), 129 bits, E=1.8e-41

Best Hits

Swiss-Prot: 38% identical to HMGD_EUBBA: 2-(hydroxymethyl)glutarate dehydrogenase (Hgd) from Eubacterium barkeri

KEGG orthology group: None (inferred from 58% identity to ret:RHE_PD00083)

MetaCyc: 38% identical to 2-(hydroxymethyl)glutarate dehydrogenase subunit (Eubacterium barkeri)
2-hydroxymethylglutarate dehydrogenase. [EC: 1.1.1.291]

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

• D-glucarate degradation I (2/4 steps found)
• D-galactarate degradation I (2/4 steps found)
• glycolate and glyoxylate degradation I (2/4 steps found)
• superpathway of glycol metabolism and degradation (4/7 steps found)
• superpathway of D-glucarate and D-galactarate degradation (2/5 steps found)
• nicotinate degradation III (3/9 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (17/31 steps found)
• superpathway of nicotinate degradation (4/18 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Nicotinate and nicotinamide metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.60

Use Curated BLAST to search for 1.1.1.291 or 1.1.1.60

Protein Sequence (301 amino acids)

>ABIE41_RS20685 NAD(P)-dependent oxidoreductase (Bosea sp. OAE506)
MPDSASAPAPIAFIGLGQMGLPMARRLIAAGFAVRGADPAEAPRQALVEAGGTAFADARE
AAEGADILITMLPNGRIVRDVLLASGAAHALANGALVIDMSSSAPTDTVGLAADLAPLGL
HLIDAPVSGGVKRAIDGSLAIMAGGAAEAVERARPVLAAMGKSIFATGPIGSGHAMKALN
NYVSAAGLVAACEALLVGGRFGLAPETIVDVLNASTGRNNSTEVKMKPFVISEAFNSGFS
LALMAKDLRIAADLADHLELPLPQIQSVAALWEAAKGGLGAQADHTEIHRHLQALAAGSR
G