Protein Info for ABIE41_RS20645 in Bosea sp. OAE506

Annotation: tripartite tricarboxylate transporter TctB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 77 to 94 (18 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details PF07331: TctB" amino acids 15 to 148 (134 residues), 50.2 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: None (inferred from 58% identity to sno:Snov_1726)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>ABIE41_RS20645 tripartite tricarboxylate transporter TctB family protein (Bosea sp. OAE506)
MAPVTRSGKDWQDLLFGLFLVAVAAGALFATRNLNVGNAADMGAGYMPRVVSLGLLAFGL
FFCGRGIRRAGLAIEPVQLRPLLAVLAAVGIFALTAEKLGLAIASVVTVVLASFATREGR
LRETVPFALLLSGAAVLLFIKVLALPVPVWPR