Protein Info for ABIE41_RS20510 in Bosea sp. OAE506

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 68 to 95 (28 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 60 to 280 (221 residues), 37.1 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: None (inferred from 79% identity to azc:AZC_3345)

Predicted SEED Role

"ABC transporter, membrane spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>ABIE41_RS20510 sugar ABC transporter permease (Bosea sp. OAE506)
MSAALDDIPLKQRLAARGVDGLTLLVVPAVIFLLLLFIYPFLYGLVLSFNPKHGGAFANY
SRFFSDSFLYGTIATTLWLALPVTLLTLVFAVPIAFRVRLLQRQRLLTTLLVIPITLGTV
LVAQGLLAYLGPQGWFNRSLMWIGLISTPIKLLHNYWGVMLSLVITGFPFTFLLTLSYLS
GIDPALEKAAATLGAGPWERFKHILFPLLLPGLAITFCLSFVQAFSVFPSAVLLGAPAGP
TRVISIAAYQAAFEEYDYSLASAIAMIMGMVQLSIVVLVLSLRGLLYRGPAGGGKG