Protein Info for ABIE41_RS20225 in Bosea sp. OAE506

Annotation: VOC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 11 to 99 (89 residues), 21.9 bits, E=2e-08
  • amino acids 138 to 247 (110 residues), 56.8 bits, E=2.9e-19

Best Hits

KEGG orthology group: K00446, catechol 2,3-dioxygenase [EC: 1.13.11.2] (inferred from 63% identity to bbt:BBta_5584)

Predicted SEED Role

"putative Metapyrocatechase (MPC) (CatO2ase) (Catechol 2,3- dioxygenase)( EC:1.13.11.2 )"

MetaCyc Pathways

• catechol degradation to 2-hydroxypentadienoate I (1/2 steps found)
• catechol degradation to 2-hydroxypentadienoate II (2/4 steps found)
• 2-nitrotoluene degradation (1/3 steps found)
• toluene degradation to 2-hydroxypentadienoate (via toluene-cis-diol) (1/4 steps found)
• toluene degradation to 2-hydroxypentadienoate I (via o-cresol) (1/4 steps found)
• catechol degradation I (meta-cleavage pathway) (1/5 steps found)
• catechol degradation II (meta-cleavage pathway) (2/7 steps found)
• toluene degradation II (aerobic) (via 4-methylcatechol) (1/6 steps found)
• toluene degradation I (aerobic) (via o-cresol) (1/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (1/7 steps found)
• meta cleavage pathway of aromatic compounds (2/10 steps found)
• naphthalene degradation to acetyl-CoA (2/12 steps found)
• toluene degradation IV (aerobic) (via catechol) (2/13 steps found)
• mandelate degradation to acetyl-CoA (4/18 steps found)
• superpathway of aerobic toluene degradation (9/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (10/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (8/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Styrene degradation
• Toluene and xylene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.2

Use Curated BLAST to search for 1.13.11.2

Protein Sequence (305 amino acids)

>ABIE41_RS20225 VOC family protein (Bosea sp. OAE506)
MSRFPVTALRSVEIGTPDIALSERFYTQVWGLEVAARQGETVCLRATGADHHVLVLKPSA
APEILSVTFRADPETDLAVLAERAVRHGARVLAGPAPTLEPGGGLLLALAEPQGGVYRFV
QGDALHDDPGESPDRASRLAHVNLNSHDVDAQARFFEQGLGFALTDRSKLMAFLRCNSDH
HAVVLADAKASGLNHIAFLVPDWESVMRASGRLVDAGYPIGWGVGRHGPGDNVFAYFVDP
VGFVVEFTAEVLQVDDAYRVRGPDEWIWPPGRTDQWGIAPPKPDHVKAAQTAIIYRPMAS
PAGFP