Protein Info for ABIE41_RS20155 in Bosea sp. OAE506

Annotation: NADH:flavin oxidoreductase/NADH oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00724: Oxidored_FMN" amino acids 3 to 340 (338 residues), 224.4 bits, see alignment E=1.2e-70

Best Hits

Swiss-Prot: 41% identical to OYEC_SCHPO: Putative NADPH dehydrogenase C23G7.10c (SPBC23G7.10c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 68% identity to rru:Rru_A0144)

Predicted SEED Role

"FMN oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>ABIE41_RS20155 NADH:flavin oxidoreductase/NADH oxidase (Bosea sp. OAE506)
MSQLFSPFQIGGLTLANRIVIAPMCQYSAENGHTTDWHTIHLGNLSHSGAGLLIIEATAV
EPAGRISPQDVGLWDDGTEAALARTLKAVRAHSEMPIAIQLAHAGRKASVAQPWHGGGQL
ALDAGGWETRAPSPVAFDGHARQPRALTSDDVARLCEQFAEAARRSVRLGFAAIELHAAH
GYLMHQFLSPLSNKREDEFGGSLENRMRFPLAAFEAVKAVVPAGYPVGVRLSATDWVPGG
WDLEQSIAFSQALKARGADFIHVSSGGNSGAQQIPLGPNYQVPFARAVKLATGLPTIAVG
LITEAEQAEAIVGTGDADLVGIARGILYDPRWPWHAAAQLGATVKVPNQYLRSQPRQFKT
LFG