Protein Info for ABIE41_RS20090 in Bosea sp. OAE506

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 3 to 232 (230 residues), 149.9 bits, E=1.6e-47
• TIGR00657: aspartate kinase
  • amino acids 63 to 407 (345 residues), 346.5 bits, E=1.3e-107
• PF01842: ACT
  • amino acids 272 to 332 (61 residues), 49.2 bits, E=5.3e-17
• PF13840: ACT_7
  • amino acids 345 to 405 (61 residues), 46.7 bits, E=3.6e-16

Best Hits

Swiss-Prot: 53% identical to AKLYS_PSEU5: Aspartate kinase Ask_LysC (lysC) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 79% identity to met:M446_4746)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-lysine biosynthesis I (8/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• aspartate superpathway (19/25 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (5/8 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Protein Sequence (412 amino acids)

>ABIE41_RS20090 aspartate kinase (Bosea sp. OAE506)
MARLVMKFGGTSVATVERIKNAARHVKREFDAGHEVAVVVSAMSGKTNELVAWCKEAAPL
YDRAEYDVVVASGEQVTSGLMALVLQEMGLPARSWQGWQIPIYGSDAHGSSRIESVDGAG
IIVGFDRNREIAVCSGFQGMHGASNRIVTLGRGGSDTSAVAIAAGLKADRCDIYTDVDGV
YTTDPRVVPKARRMDRVSFEEMLEMASLGSKVLQVRSVEIAMVHRVPTYVRSSFDDPTNP
NPGTLICDEDDIVEQQIVTGIAFSRDEAQITLRRVADKPGVAAAIFGPLADANINVDMII
QVVSDDQATTDITFTVPTADYERAKTLLESLHGQIHYQALQGATDVVKVSAIGVGMRSHA
GVAARAFRALSEKGINIRAITTSEIKFSVLIDAAYTELAVRTLHSLYGLDAA