Protein Info for ABIE41_RS19940 in Bosea sp. OAE506

Annotation: orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01367: orotate phosphoribosyltransferase
  • amino acids 6 to 190 (185 residues), 219.9 bits, E=1e-69
• PF00156: Pribosyltran
  • amino acids 46 to 154 (109 residues), 46.4 bits, E=1.4e-16

Best Hits

Swiss-Prot: 72% identical to PYRE_METPB: Orotate phosphoribosyltransferase (pyrE) from Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 73% identity to sno:Snov_1632)

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (41/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• UMP biosynthesis II (6/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Protein Sequence (194 amino acids)

>ABIE41_RS19940 orotate phosphoribosyltransferase (Bosea sp. OAE506)
MTDDEVLAEFREAGALLEGHFILSSGRRSGVFLQKMFVFQDPVRTERLCKALAAKIEARF
GKIDYVVSPAIGGIVPGYETARHLGAKAVFVEREGGSFRLRRGFTLPAGARCIIIEDIIT
TGLSLRECRHSVKDEPGTIVGAACLIDRSAGRAELGMELVSLMEYAVPDYAPDALPPELA
ALPATKPGSRGLSA