Protein Info for ABIE41_RS19920 in Bosea sp. OAE506

Annotation: histidine kinase dimerization/phosphoacceptor domain -containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 52 to 84 (33 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details PF13493: DUF4118" amino acids 24 to 128 (105 residues), 40.7 bits, see alignment E=4.4e-14 PF07568: HisKA_2" amino acids 144 to 218 (75 residues), 58.3 bits, see alignment E=1.7e-19 PF07536: HWE_HK" amino acids 144 to 201 (58 residues), 26.3 bits, see alignment E=2.5e-09 PF13581: HATPase_c_2" amino acids 240 to 322 (83 residues), 33.4 bits, see alignment E=1e-11 PF02518: HATPase_c" amino acids 244 to 333 (90 residues), 48.9 bits, see alignment E=2e-16

Best Hits

KEGG orthology group: None (inferred from 51% identity to mpo:Mpop_4695)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>ABIE41_RS19920 histidine kinase dimerization/phosphoacceptor domain -containing protein (Bosea sp. OAE506)
MKTFDLPPSLSRPQPVSGAVVGIGLACVISALAVLGRFALEGTLPAGYPFLTFFPAVIIT
SFLCGTAAGTLCAVLCGMAAWYWFIPPDGFALDRQSAFALSFYVFIVAVDIVLIHLMTRA
MRRLEAEKRLSNALAEQQRTMFEELQHRVANNMAFVASLLNMSRRRLAADPAAAPAILDD
ARNRIETMARIHRRLHDPNQVDLPVRAYLQDLCADVVETSGLSGVTCAVDVPEMTFDIRK
LTTISMLVSEVVTNSLKHAYPDGRSGHITVSLRRLAGGEAELTIADDGVGLPTMPDDASP
GHGLGNRIVEALAKQLKGSVTRQSNPGLATRILFPL