Protein Info for ABIE41_RS19690 in Bosea sp. OAE506

Annotation: beta-ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III
  • amino acids 5 to 325 (321 residues), 419.2 bits, E=5e-130
• PF00108: Thiolase_N
  • amino acids 38 to 147 (110 residues), 31.9 bits, E=1.4e-11
• PF08545: ACP_syn_III
  • amino acids 109 to 192 (84 residues), 105.8 bits, E=1.3e-34
• PF08541: ACP_syn_III_C
  • amino acids 237 to 325 (89 residues), 129.6 bits, E=6.1e-42

Best Hits

Swiss-Prot: 70% identical to FABH_BRADU: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 74% identity to mno:Mnod_7075)

MetaCyc: 38% identical to 3-oxoacyl-(acyl-carrier-protein) synthase III (Agrobacterium fabrum C58)
RXN-22027

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Protein Sequence (325 amino acids)

>ABIE41_RS19690 beta-ketoacyl-ACP synthase III (Bosea sp. OAE506)
MSILRSRIVGCGSYLPARIVTNAELAQRVDTTDEWIVQRTGIRQRHVAAESETTSVLGLK
AAQAALADAGMEPAEVDLIIVATATPDHTFPATATQIQAALGIAGGVAFDLQAVCSGFVF
ALATADKFLSTGAARTALVIGAETFSRILDWEDRTTCVLFGDGAGAVVLRAEPGEGTLAD
RGVLATHIRSDGRYKDKLYVDGGPGSTKTVGFLRMEGKEVFRHAVQNLAETVRHTFAETG
LSGADIDWFVPHQANRRIIDATADKLGIGHDRVVVTVDRHGNTSAASIPLALAEAHRDGR
IRPGQLVLIEAMGGGFTWGSALIRW