Protein Info for ABIE41_RS19640 in Bosea sp. OAE506

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02230: Abhydrolase_2
  • amino acids 16 to 192 (177 residues), 23.3 bits, E=5.2e-09
• PF00561: Abhydrolase_1
  • amino acids 82 to 146 (65 residues), 30 bits, E=4.2e-11

Best Hits

Swiss-Prot: 47% identical to MHQD_BACSU: Putative hydrolase MhqD (mhqD) from Bacillus subtilis (strain 168)

KEGG orthology group: K06999, (no description) (inferred from 68% identity to bja:bll3246)

Predicted SEED Role

"Carboxylesterase (EC 3.1.1.1)" (EC 3.1.1.1)

MetaCyc Pathways

• methylsalicylate degradation (2/2 steps found)
• aspartame degradation (1/2 steps found)
• methyl indole-3-acetate interconversion (1/2 steps found)
• superpathway of methylsalicylate metabolism (1/5 steps found)
• retinol biosynthesis (2/7 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Drug metabolism - other enzymes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1

Protein Sequence (206 amino acids)

>ABIE41_RS19640 alpha/beta hydrolase (Bosea sp. OAE506)
MDTATTTDFIHIHERGADAARAPLLLLHGTGGDERDLLGLGRAVAPGATLLSPRGQVLEG
AMPRFFKRLSEGVFDEDDLRRRTHELADFVETARERYGLAQPVALGFSNGANIAASLLLL
RPKVLAGAALLRAMSPFAQPPQADLTGKRVLILSGAMDPIVPAADVGRLARTLSTNGATV
DHRTLAAGHGLSQADINLLGGWLAVA