Protein Info for ABIE41_RS19640 in Bosea sp. OAE506

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF02230: Abhydrolase_2" amino acids 16 to 192 (177 residues), 23.3 bits, see alignment E=5.2e-09 PF00561: Abhydrolase_1" amino acids 82 to 146 (65 residues), 30 bits, see alignment E=4.2e-11

Best Hits

Swiss-Prot: 47% identical to MHQD_BACSU: Putative hydrolase MhqD (mhqD) from Bacillus subtilis (strain 168)

KEGG orthology group: K06999, (no description) (inferred from 68% identity to bja:bll3246)

Predicted SEED Role

"Carboxylesterase (EC 3.1.1.1)" (EC 3.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>ABIE41_RS19640 alpha/beta hydrolase (Bosea sp. OAE506)
MDTATTTDFIHIHERGADAARAPLLLLHGTGGDERDLLGLGRAVAPGATLLSPRGQVLEG
AMPRFFKRLSEGVFDEDDLRRRTHELADFVETARERYGLAQPVALGFSNGANIAASLLLL
RPKVLAGAALLRAMSPFAQPPQADLTGKRVLILSGAMDPIVPAADVGRLARTLSTNGATV
DHRTLAAGHGLSQADINLLGGWLAVA