Protein Info for ABIE41_RS19325 in Bosea sp. OAE506

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 131 to 159 (29 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 331 to 354 (24 residues), see Phobius details amino acids 364 to 382 (19 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details PF04932: Wzy_C" amino acids 202 to 341 (140 residues), 34.3 bits, see alignment E=9.9e-13

Best Hits

KEGG orthology group: None (inferred from 43% identity to nha:Nham_2467)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>ABIE41_RS19325 O-antigen ligase family protein (Bosea sp. OAE506)
MSALADRSGQEPARRGRLRISYATLKRGVLWLLTACSGLALIEPSPYEVVFLLALFVFAL
TGIRFSQKLLPLALLLLLYNIGGTFSLIPWMDDAAAVRFTAVSVYLMITAVFLAGIMAED
PLGRLETLRSGYLFAAWGAGLAGILGYFDIAGLGSVFTLYGRASGTFKDPNVLGPFLVLP
IVYLLHHVLIGRLGLMRGLLLMSVPLVALFLTFSRGAWGNLVGATLLMIALTFLTAPNAA
GRTRIVALTLAALGLVSVALLFALSFENIRSVFEVRASLVQEYDGGVTGRFGNQLRSIPL
LLDEPNGFGPLRFRWLFPEDPHNVYINAFASYGWLGGFSWLALMAATCLVGWRLVFQRSA
RQGHVIVLWSVLFITILQGMQIDTDHWRHMYLMLGLVWGLAALPVAPQAAPQPRSLRTTT