Protein Info for ABIE41_RS19310 in Bosea sp. OAE506

Annotation: multidrug/spermidine efflux SMR transporter subunit MdtI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 13 to 102 (90 residues), 78.3 bits, see alignment E=2.7e-26

Best Hits

Swiss-Prot: 54% identical to MDTI_KLEP7: Spermidine export protein MdtI (mdtI) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 57% identity to eae:EAE_18310)

MetaCyc: 52% identical to multidrug/spermidine efflux pump membrane subunit MdtI (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-350; TRANS-RXN0-266

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (112 amino acids)

>ABIE41_RS19310 multidrug/spermidine efflux SMR transporter subunit MdtI (Bosea sp. OAE506)
MTSALLPQSLAIAWLALAVVLEVTGSCLLKLSDGLRRRLPGALGILLVIGAFAALTQAIR
GMDLSVAYAVWGGAGLVITALVGAFAFGQRIRPSGWAGIVLVVAGVVALKSL