Protein Info for ABIE41_RS19205 in Bosea sp. OAE506

Annotation: agmatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR01230: agmatinase" amino acids 43 to 308 (266 residues), 199.2 bits, see alignment E=5.3e-63 PF00491: Arginase" amino acids 46 to 307 (262 residues), 270.1 bits, see alignment E=1.3e-84

Best Hits

Swiss-Prot: 48% identical to SPEB_EDWI9: Agmatinase (speB) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 63% identity to mes:Meso_1162)

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.11

Use Curated BLAST to search for 3.5.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>ABIE41_RS19205 agmatinase (Bosea sp. OAE506)
MTEQAGPGSIDHAFTGERRGGAADPTYAGALSFMRRRYGKDVAGCDLVIWGVPFDLAVTN
RPGARFGPQALRRASAIFDGDPQYPSGLDPFAHLTALDYGDCLLPRGDLAGCARAIEAEA
AGILASGAHLVTLGGDHFVTLPLLRAHVARHGRLALIQFDAHQDTWDDGVGAIGHGSFVL
EAVREGLIDIERSIQIGIRTVAPRDGGIDILDAYTVHELGVAGTLARIRERVGEGPAYLT
FDIDALDPAFAPATGTPVSGGLSAEQALRLVWGLRDLDIRGMDLVEVSPPYDHADITAIA
GSTLVQHHIQALALKKAG