Protein Info for ABIE41_RS18915 in Bosea sp. OAE506

Annotation: glutathione S-transferase N-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF02798: GST_N" amino acids 3 to 69 (67 residues), 31.2 bits, see alignment E=6.8e-11 PF13409: GST_N_2" amino acids 11 to 71 (61 residues), 35.7 bits, see alignment E=3.2e-12 PF13417: GST_N_3" amino acids 16 to 74 (59 residues), 41.7 bits, see alignment E=3.6e-14 PF14497: GST_C_3" amino acids 99 to 201 (103 residues), 31.2 bits, see alignment E=6.3e-11 PF00043: GST_C" amino acids 100 to 194 (95 residues), 34.2 bits, see alignment E=7.2e-12 PF13410: GST_C_2" amino acids 124 to 195 (72 residues), 26.5 bits, see alignment E=1.7e-09

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 69% identity to pde:Pden_0332)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>ABIE41_RS18915 glutathione S-transferase N-terminal domain-containing protein (Bosea sp. OAE506)
MRTLFYVPGACSLAPHITLEWIGRPYEAIRVQYGSDKLLAVNPAGAVPTLREDDGWILTQ
AGAILDYLAHQHPEAGLAGGDGARAKAEGHRWSAFFTSDMHAAFWPVFMPDRYTTDQSKA
AKAAVVEAGHRLVAKQLAVLERHLDGRAYILDGGRSVIDAYAFPMIRWAIKLLPGGLESF
PTVQALHDRLAADPNVQKVLAREAGG