Protein Info for ABIE41_RS18840 in Bosea sp. OAE506

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF12697: Abhydrolase_6" amino acids 26 to 256 (231 residues), 44.1 bits, see alignment E=6.3e-15 PF00561: Abhydrolase_1" amino acids 47 to 140 (94 residues), 30.3 bits, see alignment E=5.1e-11 PF12146: Hydrolase_4" amino acids 50 to 255 (206 residues), 40.3 bits, see alignment E=3.4e-14

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 61% identity to bur:Bcep18194_B1501)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>ABIE41_RS18840 alpha/beta fold hydrolase (Bosea sp. OAE506)
MIEAPGPAGPLAGSVLGPSDTDAPVVLIVPGSGPTDRDGNNPLGVRAFSYRLIAEGLAAR
GIRSVRIDKRGMFGSNRAIPDANAVTIEDYAEDIHTWAATIRETMRAPCVWVLGHSEGGL
SALVAAQQPDGICGLLLVSAAGRRLGDVLREQIAANPANAPVREEAEAIIAKLEAGQRVE
EGDINPALRPLFRPEVQGFLASTFALDPAKLIAAYAGPVLILQGLRDIQVGRADAERLHH
SRPDADLVLLPNANHVLKAVASDDRAANIATYQDPDSPLAEGVIEAIAGFVLARR