Protein Info for ABIE41_RS18740 in Bosea sp. OAE506

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 135 to 152 (18 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 261 to 303 (43 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 48 to 325 (278 residues), 110.6 bits, see alignment E=4e-36

Best Hits

KEGG orthology group: None (inferred from 65% identity to bja:bll3384)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator precursor" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>ABIE41_RS18740 branched-chain amino acid ABC transporter permease (Bosea sp. OAE506)
MALAGLDIEQRARPRESFGEWVARRGTAFWVVAALLVLMPAIASPFWLVQIIAYALILGM
IALSLMFLAGYGGIVSLVQMTVAGLAGYLVAILGSSAITQISLNWPWWAAVPIAILVATV
FGTLCGALSVRTEGIYTIMITLAIASAFYYLTLQNYTIFNGFSGFNGILPPVFLGVDWGQ
GIPFYYLTLCCVALAYGAVIYVSRAPFGLALQGTRDNPRRMAALGFDVVAHRIAAYGFAS
LIAACAGVLLVWYQRQISPGTAGVGPVVDMLIIAVVGGLSRPLGPFIGALVYVLLRTFAL
DVLEGLGLDGRRYQLLIGLGFLIIVLFSPDGLIGIWQRLRERYRRSDEARDGAMGGGGAR