Protein Info for ABIE41_RS18670 in Bosea sp. OAE506

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 6 to 34 (29 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 242 to 258 (17 residues), see Phobius details amino acids 278 to 295 (18 residues), see Phobius details amino acids 314 to 353 (40 residues), see Phobius details amino acids 359 to 386 (28 residues), see Phobius details amino acids 398 to 422 (25 residues), see Phobius details PF06808: DctM" amino acids 8 to 417 (410 residues), 389.9 bits, see alignment E=6.8e-121 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 423 (407 residues), 436.8 bits, see alignment E=3.5e-135

Best Hits

KEGG orthology group: None (inferred from 48% identity to mmw:Mmwyl1_0045)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>ABIE41_RS18670 TRAP transporter large permease (Bosea sp. OAE506)
MLVSAVLIGVCVVIMLGVPIAVALGLVAIGTMVATVGPDLLVIFIQRTYAGTTSFPLLAI
PFFVLAGNLMNVGGTTERIFQVAQLCMGRVRGGLAHVNVIGSVIFAGMSGSAVADAAGLG
VIEHRAMTKAGYTGRFAATITAVSATIGPVIPPSIPFVIYGSLANVSVGALFLAGIVPGL
LMALSLMAVIALVARKMNLPRGEGLPPLRDIGRIVLRAMPALLLPPAILAVIFTGIATPT
EAAVVAAGYAFVLGRFVYRELSWTDTLAVLWDSARQTAQVMFIIALAAPFGWVLVQQQIP
NAVLASLLTLSSEPWVILLVINLALLLFGMFIEGIAIMIIAYPVLLPVITQIGVDPVHFG
VILVLNIMIGLVTPPVGLCLYVVAGIAKISIAEITREIWPYVLALIGVLLLITYVPAVSL
WLPHTLGYGVAR