Protein Info for ABIE41_RS18535 in Bosea sp. OAE506

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 74 to 114 (41 residues), see Phobius details amino acids 133 to 158 (26 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 313 to 343 (31 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 399 to 421 (23 residues), see Phobius details PF06808: DctM" amino acids 6 to 415 (410 residues), 358.6 bits, see alignment E=2.3e-111 TIGR00786: TRAP transporter, DctM subunit" amino acids 15 to 421 (407 residues), 396.9 bits, see alignment E=4.6e-123

Best Hits

Swiss-Prot: 34% identical to Y4ML_SINFN: Uncharacterized protein y4mL (NGR_a02470) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 66% identity to pgv:SL003B_2495)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>ABIE41_RS18535 TRAP transporter large permease (Bosea sp. OAE506)
MLMLWGLFFLLMFLGLPVALAIGMSGFSFFVLSGSIPLGIGVQQIATASQSFPLLAVPFF
VLAGHMMNKTGITTRLVACSNVLVSWMAGGMAQVCILLSTLMGGVSGSAVADAAMEARIL
GPDMIRRGYSKGFTCAAIAVGSLITATIPPSLGLILYGFVGNVSIGRLFLAGVIPGLLMM
VALMTVVWLVARKRGYHSATKELPTRQAVWRAVVDAKWALLFPVALLLGIRAGIFTPSEI
GAFAVVYAVVVGIFLHKELTFESFMEALGEGVLDVGVIMLIILLSGMVGYALIFEQAPQE
VAEWMLGLSQNPLAIVILILISLLIAGCFVESTVLVLLLTPIFVPIVTKLGVDPVHFGIL
MMSIVTLGSMTPPVGVAMYTVCSILDCSIEEYFIESLPFIAAILAVVLFLALFPSVVLFL
PNLLM