Protein Info for ABIE41_RS18440 in Bosea sp. OAE506

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 10 to 248 (239 residues), 25.1 bits, E=2.2e-09
• PF00106: adh_short
  • amino acids 10 to 192 (183 residues), 179 bits, E=1.5e-56
• PF08659: KR
  • amino acids 10 to 178 (169 residues), 40.7 bits, E=4.9e-14
• PF13561: adh_short_C2
  • amino acids 16 to 251 (236 residues), 187.1 bits, E=8.2e-59

Best Hits

KEGG orthology group: None (inferred from 63% identity to xau:Xaut_0432)

MetaCyc: 44% identical to 2-deoxy-D-ribonate dehydrogenase (Pseudomonas simiae)
1.1.1.M55 [EC: 1.1.1.M55]

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

• ketolysis (3/3 steps found)
• ketogenesis (4/5 steps found)
• 2-deoxy-D-ribose degradation II (5/8 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Synthesis and degradation of ketone bodies

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30 or 1.1.1.M55

Protein Sequence (258 amino acids)

>ABIE41_RS18440 SDR family oxidoreductase (Bosea sp. OAE506)
MDLQIKGLRVLVTAGANGIGRATARAFAAEGAKVHICDVDRGALADMAKSDPAMTQSVCD
VSDRAAVARLMEEALAALGGLDCLVNNAGIAGPTGRVDEIAPEDWDSCVAIDLTGQFNCT
RLAVPHLKQSTNASIVNLSSQAGKHGFPLRSPYAAAKWGVIGFTKALSAELGEFGIRANA
ICPGLVEGPRIQSVIANKARSFNVSHDEMTQRLFAGVSIKQFVDPADIAKQIVFLASPFA
KTISGQEISVCGDTRMLA