Protein Info for ABIE41_RS18430 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 84 to 110 (27 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 283 (184 residues), 114.2 bits, see alignment E=3e-37

Best Hits

Swiss-Prot: 40% identical to DPPC_BACPE: Dipeptide transport system permease protein DppC (dppC) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 59% identity to bbr:BB2363)

MetaCyc: 43% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>ABIE41_RS18430 ABC transporter permease (Bosea sp. OAE506)
MSPEPALATPAKPPRKPMPLQLKAGLAITGTILLLGLLAPWIAPHPWDTISMRTRFLAPN
ATYWLGTDEYGRDVLSRLLMGARLSIGMGVAATLFSLAIGVPMGLAAGYFRGWVDEALMR
LADVLMAIPPIMLGLLVLAVTPPALWKTALAVGFVYIPPIARLARSVTLTLANEEFVQAA
KARAESTSYILFREILPNAWPPLIVEASLRVTYAILLGSALSFLGLGAQPPSSDWGLMIS
EARSFLDRAPWIALAPGLAMCLLVIGINLLGDGARERLDPRLKARLGKA