Protein Info for ABIE41_RS18325 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 66 to 91 (26 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 257 (177 residues), 50.3 bits, see alignment E=1.2e-17

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 85% identity to azc:AZC_1989)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>ABIE41_RS18325 ABC transporter permease (Bosea sp. OAE506)
MTAIERIASAVVWTLAAFTVVFLLTPLVVTVLVSFGSSAVFTLPAPSWSLRWYQALGRSR
ELWPVVATSVQLAALSTAIALGLGTLCAIGLLRGQFRGRDGIVTFLVSPLMLPGLVIGIA
MLESFRAAGLRDVWLSLILAHVVITLPYVVRTVYAALSLFDFTLIDAARTLGLSYPKAVL
KVLVPSLAPAFLTSGMFAFLASMDNYPISIFFTDAWTKTLPIQMLQYVEESPDPTIAAIS
ALLILLAAAVLVVGDRLVGLRRMADL