Protein Info for ABIE41_RS18320 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details amino acids 26 to 27 (2 residues), see Phobius details transmembrane" amino acids 12 to 25 (14 residues), see Phobius details amino acids 36 to 53 (18 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 144 to 268 (125 residues), 46.7 bits, see alignment E=1.5e-16

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 84% identity to azc:AZC_1990)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>ABIE41_RS18320 ABC transporter permease (Bosea sp. OAE506)
MNASRRLDPVLLLALPAVLYLAIVYGVPLMMLLGRSILVGGVPSLAPFIGFLSDPFSWTV
IGNTLRIAVLVTLVCLLIGYPTALALARASGLAQALILVAIILPLSVGVVVKAFAWQIVL
RRDGVVSQLMTGLGLWSEPQRLLFTEAGLVIGAANVFVPFMILPIYSVLKLVDPRLGEAA
ATLGASPLYRFFKVALPLSLPGIVTGIAFVFSMAASMYVIPNLLIGDRFQTLATLTGRSF
LFMRNEQLGSTTAVVLLVLTVAVVVGSAALSKRLGGAS