Protein Info for ABIE41_RS18200 in Bosea sp. OAE506

Annotation: glycerophosphodiester phosphodiesterase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03009: GDPD
  • amino acids 24 to 241 (218 residues), 64.2 bits, E=1e-21

Best Hits

KEGG orthology group: None (inferred from 60% identity to mno:Mnod_7459)

Predicted SEED Role

"Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 3.1.4.46)

MetaCyc Pathways

• glycerophosphodiester degradation (2/2 steps found)
• glycerol and glycerophosphodiester degradation (3/4 steps found)
• phosphatidylcholine resynthesis via glycerophosphocholine (1/2 steps found)
• phospholipid remodeling (phosphatidylethanolamine, yeast) (2/4 steps found)
• anandamide biosynthesis I (3/12 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.46

Use Curated BLAST to search for 3.1.4.46

Protein Sequence (259 amino acids)

>ABIE41_RS18200 glycerophosphodiester phosphodiesterase family protein (Bosea sp. OAE506)
MRGPLLNNGARPDLGWLVARPIAHRGLHDAVAGVIENSGPAAEAAIAHGFGIECDIQLSA
DGEAMVFHDFVLDRLTERQGAVSAQTAEALAAIPLRGSQALIPTLSGFLDLIGGRVPLVI
EIKSRFDGDLRLTQRAAEIVAGRAGQPIVFKSFDPEIVAALREIAPGVPRGIVAMNDYSY
PDYAHLDAGQRRAMANLLHFEQSRPDFLSWKVADLDSAAPYLCRNVVGMPLMSWTVRTPE
DREKAGRLADQMVFEGFTP