Protein Info for ABIE41_RS17690 in Bosea sp. OAE506

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 transmembrane" amino acids 79 to 98 (20 residues), see Phobius details PF01638: HxlR" amino acids 17 to 103 (87 residues), 66.3 bits, see alignment E=9.1e-23

Best Hits

KEGG orthology group: None (inferred from 87% identity to ara:Arad_0489)

Predicted SEED Role

"Transcriptional regulator, HxlR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (143 amino acids)

>ABIE41_RS17690 helix-turn-helix domain-containing protein (Bosea sp. OAE506)
MQNLDDQPCLIARSLSLVGDAWSLLIMRDAHAGLTRFDEFRKSLGIAPTILTRRLAALTE
DGLLEKRRYSERPPRDDYVLTRAGLDLLPVLFAIGAWGRKHRSTKGVTRFFDAEKGSEID
PVVIDSATGAPIGTRQIRIVPPG