Protein Info for ABIE41_RS17195 in Bosea sp. OAE506

Annotation: Holliday junction resolvase RuvX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF03652: RuvX" amino acids 19 to 150 (132 residues), 141.6 bits, see alignment E=9.9e-46 TIGR00250: putative transcription antitermination factor YqgF" amino acids 21 to 150 (130 residues), 111.1 bits, see alignment E=2e-36

Best Hits

Swiss-Prot: 72% identical to YQGF_METSB: Putative pre-16S rRNA nuclease (Msil_0742) from Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 72% identity to msl:Msil_0742)

Predicted SEED Role

"Putative Holliday junction resolvase YqgF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>ABIE41_RS17195 Holliday junction resolvase RuvX (Bosea sp. OAE506)
MSSNVVTLEAFAALPDHARLLGLDLGTKTIGLALSDVERRIATPLETIKRIKFTQDAAVL
LQIAAKYGVAGLVVGLPLNMDGTEGPRVQSTRAFVRHLVPLTSLPILFWDERMSTLAVTR
TLLDADASRAKRAAVVDKMAAAYILQGALDRLTRIENAAADEADPDQP