Protein Info for ABIE41_RS17195 in Bosea sp. OAE506
Annotation: Holliday junction resolvase RuvX
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to YQGF_METSB: Putative pre-16S rRNA nuclease (Msil_0742) from Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 72% identity to msl:Msil_0742)Predicted SEED Role
"Putative Holliday junction resolvase YqgF"
Isozymes
Compare fitness of predicted isozymes for: 3.1.-.-
Use Curated BLAST to search for 3.1.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (168 amino acids)
>ABIE41_RS17195 Holliday junction resolvase RuvX (Bosea sp. OAE506) MSSNVVTLEAFAALPDHARLLGLDLGTKTIGLALSDVERRIATPLETIKRIKFTQDAAVL LQIAAKYGVAGLVVGLPLNMDGTEGPRVQSTRAFVRHLVPLTSLPILFWDERMSTLAVTR TLLDADASRAKRAAVVDKMAAAYILQGALDRLTRIENAAADEADPDQP