Protein Info for ABIE41_RS17170 in Bosea sp. OAE506

Annotation: putative sulfate exporter family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 165 to 191 (27 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 298 to 323 (26 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 18 to 334 (317 residues), 226.7 bits, see alignment E=1.7e-71

Best Hits

KEGG orthology group: None (inferred from 59% identity to mno:Mnod_2706)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>ABIE41_RS17170 putative sulfate exporter family transporter (Bosea sp. OAE506)
MSIATTTRVSAWRPLLDGIALSAAVAVAAYIAEPLVKSAAGGRFGIPAVVIALVIGMVLH
PLANAPRFQAGMTFCVKKMLRWAIALLGLRVALGDIIALGATTALLVIVAMAATILSGFL
LARWLGRETGMGALGGVATAVCGASAALATATVVPDYKSKAADVAFTVIAMNALSTVAML
AYPLLCVWLGFTPAQTGILLGATIHDVAQVVGAGQSVSVEASNAAIIVKLFRVFLLLPAV
LIVGWWLVHDDAKRAGGVADRAKVPVPVFAIMFLVLCLVNSVLLLQPGLAPLYSPLRSLL
LAISGWGLLIAIAALGLGTSLGAMARLGWRHLALVTGTSLVILVIVTAGLIALG