Protein Info for ABIE41_RS16815 in Bosea sp. OAE506

Annotation: lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 79% identical to LIPA_METC4: Lipoyl synthase (lipA) from Methylobacterium extorquens (strain CM4 / NCIMB 13688)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 79% identity to mea:Mex_1p3000)

MetaCyc: 45% identical to lipoyl synthase (Homo sapiens)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

lipoate biosynthesis and incorporation I (2/2 steps found)
lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>ABIE41_RS16815 lipoyl synthase (Bosea sp. OAE506)
MALVLDLLNRDPRPNVGNPKAEAAQAPAELRHPEKQKRPENPILRKPDWIRVKAPGSPKW
AETQKIVKAEKLVTVCEEAGCPNIGECWEKKHATFMIMGDTCTRACAFCNVKTGVPQPLD
PLEPAKVAQAVAKLGLEHVVITSVDRDDLKDGGAEHFAQVIRAIRKASPGTTIEILTPDF
LRKPGALEVVVAAKPDVFNHNLETVPGKYLTVRPGARYFHSLRLLQRVKELDPTIFTKSG
IMVGLGEERNEILQLMDDLRSADVDFITIGQYLAPSRKHHAVIRFVTPEEFKGFEAIAYA
KGFLMVSSTPLTRSSHHAGEDFARLRAAREAKVGIGHNSRG