Protein Info for ABIE41_RS16640 in Bosea sp. OAE506

Annotation: (2Fe-2S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 4 to 56 (53 residues), 43.1 bits, E=4.9e-15
• PF01799: Fer2_2
  • amino acids 71 to 143 (73 residues), 83.4 bits, E=1.5e-27

Best Hits

Swiss-Prot: 55% identical to IORA_BREDI: Isoquinoline 1-oxidoreductase subunit alpha (iorA) from Brevundimonas diminuta

KEGG orthology group: K07302, isoquinoline 1-oxidoreductase, alpha subunit [EC: 1.3.99.16] (inferred from 85% identity to smk:Sinme_6006)

MetaCyc: 73% identical to 2-deoxy-D-ribose dehydrogenase alpha subunit (Pseudomonas simiae)
1.1.2.M2 [EC: 1.1.2.M2]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

MetaCyc Pathways

• 2-deoxy-D-ribose degradation II (5/8 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.1.2.M2 or 1.3.99.16

Protein Sequence (148 amino acids)

>ABIE41_RS16640 (2Fe-2S)-binding protein (Bosea sp. OAE506)
MELTINGSKQRVDVEPDTPLLWVLRDELGLTGTKYGCGAAQCGACTVLVDGQATRSCVTP
VESVAGSAITTIESVEADPVGRRVVEAWVAHQVPQCGYCQSGQVMAATALLKQTPQPSEA
DIAGAMINLCRCGTYNAIAAAVRDAARG