Protein Info for ABIE41_RS16525 in Bosea sp. OAE506

Annotation: 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02798: 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase
  • amino acids 4 to 223 (220 residues), 372 bits, E=4.9e-116
• PF03737: RraA-like
  • amino acids 29 to 173 (145 residues), 153.8 bits, E=2.1e-49

Best Hits

Swiss-Prot: 70% identical to HMGA_PSEOC: 4-hydroxy-4-methyl-2-oxoglutarate aldolase/4-carboxy-4-hydroxy-2-oxoadipate aldolase (proA) from Pseudomonas straminea

KEGG orthology group: K10218, 4-hydroxy-4-methyl-2-oxoglutarate aldolase [EC: 4.1.3.17] (inferred from 76% identity to azc:AZC_3351)

MetaCyc: 70% identical to 4-oxalocitramalate aldolase subunit (Pseudomonas straminea)
4-hydroxy-4-methyl-2-oxoglutarate aldolase. [EC: 4.1.3.17]; 4.1.3.17 [EC: 4.1.3.17]; Malate dehydrogenase (oxaloacetate-decarboxylating). [EC: 4.1.3.17, 1.1.1.38, 1.1.1.40, 1.1.1.83, 4.1.1.112]

Predicted SEED Role

"4-carboxy-4-hydroxy-2-oxoadipate aldolase (EC 4.1.3.17)" (EC 4.1.3.17)

MetaCyc Pathways

• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (12/14 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• glyoxylate cycle (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• gluconeogenesis I (10/13 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• methylaspartate cycle (14/19 steps found)
• D-malate degradation (1/1 steps found)
• gallate degradation I (3/4 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• methylgallate degradation (4/6 steps found)
• formaldehyde assimilation I (serine pathway) (9/13 steps found)
• 4-hydroxy-4-methyl-L-glutamate biosynthesis (1/2 steps found)
• mixed acid fermentation (11/16 steps found)
• gallate degradation II (3/5 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (5/8 steps found)
• chitin deacetylation (2/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
• gluconeogenesis III (7/12 steps found)
• gentisate degradation II (1/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (6/11 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
• superpathway of vanillin and vanillate degradation (5/10 steps found)
• reductive TCA cycle II (6/12 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)
• syringate degradation (5/12 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (18/56 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Carbon fixation in photosynthetic organisms
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.40, 1.1.1.83

Use Curated BLAST to search for 1.1.1.38 or 1.1.1.40 or 1.1.1.83 or 4.1.1.112 or 4.1.3.17

Protein Sequence (227 amino acids)

>ABIE41_RS16525 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase (Bosea sp. OAE506)
MTPVVIRTRARAPAAAMADLGALGVSTTHEAMGRTGLMKPYLRPIYAGAQIAGGAVTVLA
QPGDNWMIHVAIEQIQPGDVLVVACTADNTDGMFGDLLATSLKARGGVGLVIDAGVRDVR
TLTEMGFPVWSRAISAKGTVKATLGSVNIPVVCAGALVHPGDVVVADDDGVVVVPRLEAE
SVAAAGRKREANEDEKRRRLASGELGLDMYGMREGLAKAGLVYRDGD