Protein Info for ABIE41_RS16170 in Bosea sp. OAE506

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 753 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 151 to 175 (25 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details amino acids 421 to 444 (24 residues), see Phobius details amino acids 463 to 483 (21 residues), see Phobius details amino acids 516 to 535 (20 residues), see Phobius details amino acids 541 to 563 (23 residues), see Phobius details PF21088: MS_channel_1st" amino acids 525 to 560 (36 residues), 29.7 bits, see alignment (E = 5.1e-11) PF00924: MS_channel_2nd" amino acids 562 to 626 (65 residues), 57.5 bits, see alignment E=1.2e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (753 amino acids)

>ABIE41_RS16170 mechanosensitive ion channel family protein (Bosea sp. OAE506)
MGSGFVCGRLIAALGALGLVLATTPSSRAQSPAQPPVILTLSGEETPETVSRMVEALSRE
GRQVEIRIGGVPAAAKPTPTAAKPAPQPKADASASAAIPASTAQVEAFVDHLVEGFDYGA
ASVPRIGDLAQDWERAWQDRRNGRDGLSAGLRMGLILLLALAAAGVFRIASAGFFASRMR
PKGPEFTPRLIASSWGLLQDLATIVLALLVARMARNAWLPEPDIVAATLTTTANGAAIGA
VYVAVGRFLLSPGAPGRRIMPLPRAERHFGLLLFYSAVTPAIIVALLLAGRIGSGPQPLA
GLLMVTGLVALLFKLWWFHDMRRDLAALILKGSPEPGPWRRLIALSAPWFYMGTALALWA
VGRAAAMMSDGGRWAEAAALTQTAIVITPILAVGIGSWLDCRAARRAVAEGATPLSQATG
AALRAAAVGILWAAGFFVLARLWAGLLVGMSTTQFTGVSRQAAGVAIFAFVGWVALVFLR
VFFDACAPKPRASGPVEEEDGHGDSVPSRLATVLPVLRGVVLGAVLGLTILIVLSRMGVD
IGPLLAGFGILGLALSFGSQALVRDIVSGVFFMLEDAFRVGEYVDTGRLKGTVEKISLRS
MQLRHQSGQIHTIPFGQIQQLTNASRDWATIKFNVRLDHSADIEQARKTIKKVGLALLED
PEFGPHFIAQLKMQGVADITDSAVVIRLKFTAKPAQASTLQREALKRVYRALNEARVPFA
SNLVTVRGGEGGSTSGAAAIAAVPPPSPLAPAG