Protein Info for ABIE41_RS15980 in Bosea sp. OAE506

Annotation: disulfide bond formation protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 58 (19 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details PF02600: DsbB" amino acids 7 to 85 (79 residues), 45.1 bits, see alignment E=7.2e-16

Best Hits

KEGG orthology group: None (inferred from 65% identity to azc:AZC_0989)

Predicted SEED Role

"PROBABLE TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>ABIE41_RS15980 disulfide bond formation protein B (Bosea sp. OAE506)
MSPSLARTLSAFGLLAVSLVLIAAFLDQFVMGELPCPLCLLQRVGFMGAALGLALNVKFG
PRPAHYAVTILSACFGGMVSIRQILGHIVPGTGTYGSAILGLHFYSWALLVFGAIVLGCT
ALLFFERQFERADPVPLRATMVGSAMVALAAALALANGVSTVLECGAGLCPDNPVAYEWL
QGLKRP