Protein Info for ABIE41_RS15950 in Bosea sp. OAE506

Annotation: methionine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 PF00133: tRNA-synt_1" amino acids 4 to 221 (218 residues), 45.2 bits, see alignment E=1.2e-15 amino acids 226 to 338 (113 residues), 48.1 bits, see alignment E=1.5e-16 TIGR00398: methionine--tRNA ligase" amino acids 7 to 486 (480 residues), 511.6 bits, see alignment E=1.4e-157 PF09334: tRNA-synt_1g" amino acids 8 to 364 (357 residues), 345.8 bits, see alignment E=5.8e-107 PF19303: Anticodon_3" amino acids 376 to 508 (133 residues), 42 bits, see alignment E=1.8e-14

Best Hits

Swiss-Prot: 66% identical to SYM_RHIME: Methionine--tRNA ligase (metG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01874, methionyl-tRNA synthetase [EC: 6.1.1.10] (inferred from 71% identity to mno:Mnod_6921)

Predicted SEED Role

"Methionyl-tRNA synthetase (EC 6.1.1.10)" (EC 6.1.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>ABIE41_RS15950 methionine--tRNA ligase (Bosea sp. OAE506)
MATAPKFYLTTAIHYTNGPPHIGHAYEMVASDAIARFKRLDGYDVFAMTGTDEHGQKVQR
TASQNGQSPKDFVDGIAGRFQQMEERLGCSFDRFIRTTDADHLPSTQELWRRMEANGDIY
LSKYAGWYSIRDEAFYAEEETTLLADGTRLGGQGTPVEWVEEESYFFRLKAYQERLLKLY
EEVPDFVSPPTRRNEIVSFVKAGLEDLSISRTTFDWGLPVPGDPKHVMYVWVDALNNYVT
GTGFPDPQNPRAHYWPADVHIIGKDIVRFHTVYWPAFLMSAGLPLPKRVFGHGFLLSKGE
KMSKSLGNVVDPFGLADAYGVDQLRYFFLREVSFGQDGNYSHDAIVGRINADLANDLGNL
AQRSLSMIAKNCEGRVPSCGALTEADQAMLALADGALTKAREAMTDFALHVVLSEIWAVV
AEANRYFASNEPWRLSKTEPERRDTVLYVTAEVIRQVAILVQPVMPSSMAKLLDLLGVPA
GKRDFAALGEGGRLASGTALPAPSGIFPRYVEPEGGEAA