Protein Info for ABIE41_RS15615 in Bosea sp. OAE506

Annotation: 3-mercaptopyruvate sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF00581: Rhodanese" amino acids 9 to 129 (121 residues), 40.8 bits, see alignment E=1.3e-14 amino acids 159 to 272 (114 residues), 37.6 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 44% identical to THTM_RAT: 3-mercaptopyruvate sulfurtransferase (Mpst) from Rattus norvegicus

KEGG orthology group: K01011, thiosulfate/3-mercaptopyruvate sulfurtransferase [EC: 2.8.1.1 2.8.1.2] (inferred from 66% identity to mno:Mnod_6380)

MetaCyc: 44% identical to 3-mercaptopyruvate sulfurtransferase (Rattus norvegicus)
3-mercaptopyruvate sulfurtransferase. [EC: 2.8.1.2]

Predicted SEED Role

"Thiosulfate sulfurtransferase, rhodanese (EC 2.8.1.1)" (EC 2.8.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.1 or 2.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>ABIE41_RS15615 3-mercaptopyruvate sulfurtransferase (Bosea sp. OAE506)
MPSDTVFVSTEWLAERLDAPDVVVVDGSWYLPVHARDPHAEYAERRIPGALRFDIDAVKD
AGSDLPHMLPRPETFAAAVGAMGIGDGMRIVVYDGLGLFSAPRVRWTFRTFGAKDVVILE
GGFPKWQAENRPIEQGPPRTRAARSFTARLDHSAVADAGDIARALAEGTAQVVDARPGDR
FRGEAPEPRAGVRSGHMPGSLNLPFPAIVENGQLKSPQAIAAAFAEAGVDLDRPLITSCG
SGVSAAILSTALETIGKPARALYDGSWAEWGASDRPLATGPAKRG