Protein Info for ABIE41_RS15575 in Bosea sp. OAE506

Annotation: M20 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 TIGR01891: amidohydrolase" amino acids 19 to 418 (400 residues), 247.8 bits, see alignment E=9.8e-78 PF01546: Peptidase_M20" amino acids 76 to 315 (240 residues), 41.5 bits, see alignment E=1.5e-14 PF07687: M20_dimer" amino acids 188 to 278 (91 residues), 24.2 bits, see alignment E=2.8e-09

Best Hits

KEGG orthology group: K12941, aminobenzoyl-glutamate utilization protein B (inferred from 82% identity to mno:Mnod_1357)

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit B" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>ABIE41_RS15575 M20 family metallopeptidase (Bosea sp. OAE506)
MDNRNDLWRHVDANKERLIALSERVWGMPEVCYTETRSSAEHEAELVHQGFRVTKGIADI
PTSVIGEAGEGGPVIAFMGEYDALPGLSQEAGVASHSPVETGGHGHGCGHNLLGSAALLA
AVAMKNWLAENKLPGRVRYYGCPAEEGGAAKAFMVRAGAFDDADVAISWHPSSWWEVAPP
LALANTRADFTFTGRTAHAAAAPHLGRSALDAVELMNVGVNYMREHMPSDARVHYAVLDT
GGIAPNVVQAHARVRYSIRARDLRGMLELVQRVKKIAEGAALMTETKMEMRIVSAVSDLL
GNTPLEQAMHGVMEELGPPHFDDADRAFAQEIRKTLQAQEIASIWRTIGMDDTGAPLADF
LVPMDAKRNPAIGSTDIGDVSWAVPTVQAHAPTVAIGTPFHTWQVVAQGKSPAAHKAMVH
VAKAMAATGAAVLLDPALMAAAKADHKKRLGAEGYTSPLPPEVKPPLTMSLGG