Protein Info for ABIE41_RS14950 in Bosea sp. OAE506

Annotation: iron-sulfur cluster assembly accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 PF01521: Fe-S_biosyn" amino acids 11 to 110 (100 residues), 69.9 bits, see alignment E=1.1e-23 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 11 to 114 (104 residues), 120 bits, see alignment E=2.5e-39

Best Hits

Swiss-Prot: 44% identical to ERPA_AERHH: Iron-sulfur cluster insertion protein ErpA (erpA) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)

KEGG orthology group: None (inferred from 65% identity to azc:AZC_2808)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (115 amino acids)

>ABIE41_RS14950 iron-sulfur cluster assembly accessory protein (Bosea sp. OAE506)
MTTSLEAPVSVAVTEKAASRILAVMATEPPGSMLRVSVAGGGCSGFQYVFDVDREKAPGD
IVIERDGATVLIDETSLDLLAGSTIDFVDDLIGQSFKITNPNATSSCGCGTSFAL