Protein Info for ABIE41_RS14950 in Bosea sp. OAE506
Annotation: iron-sulfur cluster assembly accessory protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 44% identical to ERPA_AERHH: Iron-sulfur cluster insertion protein ErpA (erpA) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)
KEGG orthology group: None (inferred from 65% identity to azc:AZC_2808)Predicted SEED Role
"probable iron binding protein from the HesB_IscA_SufA family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (115 amino acids)
>ABIE41_RS14950 iron-sulfur cluster assembly accessory protein (Bosea sp. OAE506) MTTSLEAPVSVAVTEKAASRILAVMATEPPGSMLRVSVAGGGCSGFQYVFDVDREKAPGD IVIERDGATVLIDETSLDLLAGSTIDFVDDLIGQSFKITNPNATSSCGCGTSFAL