Protein Info for ABIE41_RS14675 in Bosea sp. OAE506

Annotation: 50S ribosomal protein L17

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 TIGR00059: ribosomal protein bL17" amino acids 8 to 117 (110 residues), 140.6 bits, see alignment E=1.3e-45 PF01196: Ribosomal_L17" amino acids 20 to 116 (97 residues), 132.1 bits, see alignment E=5.6e-43

Best Hits

Swiss-Prot: 84% identical to RL17_METSB: 50S ribosomal protein L17 (rplQ) from Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)

KEGG orthology group: K02879, large subunit ribosomal protein L17 (inferred from 84% identity to msl:Msil_2992)

MetaCyc: 58% identical to 50S ribosomal subunit protein L17 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L17p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>ABIE41_RS14675 50S ribosomal protein L17 (Bosea sp. OAE506)
MRHGFRGRRFNRSVEHRKAMFANMSQALIKHEQITTTLPKAKDLRPVVEKLITLAKRGDL
HARRQAIAQIKDVALVGKLFAVLGPRYKERNGGYLRIMKAGFRFGDNAPLAVIEFVDRDV
EAKGKDSGPVFTADDEAA