Protein Info for ABIE41_RS14445 in Bosea sp. OAE506

Annotation: TRAP transporter large permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 102 to 136 (35 residues), see Phobius details amino acids 148 to 175 (28 residues), see Phobius details amino acids 184 to 208 (25 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 365 to 388 (24 residues), see Phobius details amino acids 394 to 411 (18 residues), see Phobius details amino acids 431 to 454 (24 residues), see Phobius details amino acids 471 to 497 (27 residues), see Phobius details amino acids 508 to 534 (27 residues), see Phobius details amino acids 549 to 574 (26 residues), see Phobius details PF06808: DctM" amino acids 11 to 207 (197 residues), 100.8 bits, see alignment E=4e-33 amino acids 348 to 570 (223 residues), 135 bits, see alignment E=1.7e-43

Best Hits

KEGG orthology group: None (inferred from 74% identity to rhi:NGR_c19420)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (582 amino acids)

>ABIE41_RS14445 TRAP transporter large permease subunit (Bosea sp. OAE506)
MSDPALGLSMLGLIVVVIILGFPTAFTLMGLGMIFGYAAFYDPTQAWYANRIFDLMVQRT
YGAMTNDVLISIPLFVLMGYVMERGALVDKMFYAVQLAFRNVPAALAVATLLVCTFWGIA
SGLVGAVVVLMGVIAFNPMLKAGYDVRLASGVITAGGTLGILIPPSVMIIVYAAVAGQSV
VKLYAAAMFPGFFLAFLYLIYIVGWALLNPRVAPKLPPEQTQVPVPDWTRALAEPHRGRV
FPALSRALLSPRRARGILRDGQPVTRGALLQAWGYALVPLTLITLTLAVVWWYVVIHQQA
GAAEAVTAVEQLGTPDLVPDDAGEGSKGPPTAFYLWFGGIAFGFAVLMARYYARMTAERL
EVIRMLTDAVLPLGLLTAVVLAVILFGITTATESAAVGAAGAFLLAFHARSLNWKRIKEA
VFLTAKTTSMVCWLFVGSAIFSAVFALLGGQALLESWVLSLDLSPLQFMILSQAIIFVLG
WPLEWTEIIVIFVPIFLPMLKHFGIDPILWGVLVFVNLQAAFLSPPVAMSAFYLKGVAPS
HVTINQIFAGMMPYMLIVILCMVLMYLWPGLTLWLPEYLYGG