Protein Info for ABIE41_RS14185 in Bosea sp. OAE506

Annotation: 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 TIGR00186: RNA methyltransferase, TrmH family, group 3" amino acids 51 to 281 (231 residues), 163.8 bits, see alignment E=2.4e-52 PF08032: SpoU_sub_bind" amino acids 53 to 123 (71 residues), 36.6 bits, see alignment E=4.7e-13 PF00588: SpoU_methylase" amino acids 135 to 275 (141 residues), 125.2 bits, see alignment E=2.2e-40

Best Hits

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 66% identity to met:M446_2905)

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>ABIE41_RS14185 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB (Bosea sp. OAE506)
MPAPFRPKSDRDRPDRDRPRREGGRGDGPRQTSPRRADGTLHHRPGDIDEAVLYGVHPVI
EALRNPKRRHRRLLATENGVKRLQEEIGDLPLEPEIVRPSEIDRLLTPDSVHQGLYLVCD
PLPSLDLDSLPHDAIVLALDQITDPHNVGAILRSAAAFGAAAVIVTIRHSPAATGVLAKS
ASGALEHVPLIAVRNLGDALAELGKRGFQRIGFDSDGEVAFEDVALTRPLVMVMGAEGKG
LRQRSRELCDQVARLEVPGAITSLNVSNATAIALYAASRRR