Protein Info for ABIE41_RS13855 in Bosea sp. OAE506

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 16 to 33 (18 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details PF00892: EamA" amino acids 18 to 150 (133 residues), 57.4 bits, see alignment E=8.8e-20 amino acids 168 to 300 (133 residues), 54.8 bits, see alignment E=5.9e-19

Best Hits

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>ABIE41_RS13855 DMT family transporter (Bosea sp. OAE506)
MTDLASPAAALARRRLWLGIGCGLLTSLIWGVQSVVSRQSVADGLSAADVTILRFVVASL
ILLPLARRRMRPFPVGALGWRRALILTALAGAPYALVLVGGATFAPALHASVIVPGLIPV
MTVALAFLVLGERPGPLRLLGLALVLAGIGAFGWQAFGESGAGANAWIGDLFFVTNAVMW
SVFGLLALRWRTDAIDVTIATCLLSLLILPVFAATMPIRLGEVAWSAIALQALYQGALVG
VGALFLYTKSVELLGAGRATLFLPLNPVVTALAAILLLGEYPSPIEVAGIVLVIAGMSVA
LRAR