Protein Info for ABIE41_RS13670 in Bosea sp. OAE506

Annotation: 3-oxoadipate enol-lactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02427: 3-oxoadipate enol-lactonase
  • amino acids 14 to 257 (244 residues), 306.3 bits, E=7.7e-96
• PF00561: Abhydrolase_1
  • amino acids 22 to 153 (132 residues), 59.1 bits, E=1.1e-19
• PF12697: Abhydrolase_6
  • amino acids 31 to 250 (220 residues), 52.1 bits, E=2.9e-17
• PF12146: Hydrolase_4
  • amino acids 48 to 229 (182 residues), 30.3 bits, E=5.1e-11
• PF08386: Abhydrolase_4
  • amino acids 185 to 257 (73 residues), 25.2 bits, E=2.9e-09

Best Hits

Swiss-Prot: 43% identical to ELH2_ACIAD: 3-oxoadipate enol-lactonase 2 (catD) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 58% identity to swi:Swit_0978)

MetaCyc: 49% identical to subunit of 3-oxoadipate enol-lactone hydrolase (Pseudomonas putida)
3-oxoadipate enol-lactonase. [EC: 3.1.1.24]

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• aromatic compounds degradation via β-ketoadipate (6/9 steps found)
• catechol degradation to β-ketoadipate (2/4 steps found)
• superpathway of salicylate degradation (4/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (3/6 steps found)
• toluene degradation III (aerobic) (via p-cresol) (6/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
• mandelate degradation to acetyl-CoA (4/18 steps found)
• superpathway of aerobic toluene degradation (9/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (10/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Protein Sequence (259 amino acids)

>ABIE41_RS13670 3-oxoadipate enol-lactonase (Bosea sp. OAE506)
MPIETLAGEPFNIRFDGPADAPVLMLSNSLGTNLSMWDPQIPEWSKRFRVLRYDSRGHGL
SVATDRAFAIDTLGRDALAILDHFGIERAHWCGVSKGGMVGQWLATNARERMGRLVLANT
AAHMGPPSLWDDRIAMARSQGMDALVQGVLARWFSPRFREAEPATVTRVGTMLTTTPAIG
YATCCAAIRDMDQRESIRSVTNPVLVVIGTVDPATPPAAGHLIAQAIPGARTVELDAAHL
SNLEQPEAFTKAVLDFLSE