Protein Info for ABIE41_RS13660 in Bosea sp. OAE506

Annotation: flavin reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01613: Flavin_Reduct
  • amino acids 22 to 171 (150 residues), 134.1 bits, E=2.2e-43

Best Hits

Swiss-Prot: 47% identical to RUTF_STAND: FMN reductase (NADH) RutF (rutF) from Starkeya novella (strain ATCC 8093 / DSM 506 / CCM 1077 / IAM 12100 / NBRC 12443 / NCIB 9113)

KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 52% identity to bgl:bglu_2g19770)

MetaCyc: 38% identical to FAD reductase (NADH) (Cupriavidus pinatubonensis JMP134)
RXN-8506 [EC: 1.5.1.37]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Methane metabolism
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.- or 1.5.1.37

Protein Sequence (172 amino acids)

>ABIE41_RS13660 flavin reductase family protein (Bosea sp. OAE506)
MTDTVSLQPRVAPEAASFRDAMAGVASAVHVVTTLGPAGRVGLTATAVASVSDSPPTVLV
CIARPSRTLAVIEAAGLFCINTLPGDALELAEIFASRRGIEGEARFATRNWTTLATGAPV
LSEAVAAFDCRLTAIHDVATHRILIGEVLGLGGAVAAPGSSLIYRQRQFQAV