Protein Info for ABIE41_RS13295 in Bosea sp. OAE506

Annotation: flagellar assembly protein FliX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF10768: FliX" amino acids 3 to 133 (131 residues), 127 bits, see alignment E=3.7e-41

Best Hits

Swiss-Prot: 34% identical to FLIX_CAUVC: Flagellar assembly protein FliX (fliX) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 50% identity to mrd:Mrad2831_5551)

Predicted SEED Role

"Flagellar trans-acting factor FliX" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>ABIE41_RS13295 flagellar assembly protein FliX (Bosea sp. OAE506)
MIRIDQRAPISNAGPAGSARRAGGAAFTLPTKDSAASSRSAGIAASGPLDTLLAVQAYEE
PQERKKRQAKRGHDLLDGLDRLKAALLSGRVNLSELEQIRTNLAQRREATDDPRLDDVLA
HIELRAAVELAKLGR